WH0010413M1

Monoclonal Anti-YAP1 antibody produced in mouse

clone 2F12, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-YAP, Anti-YAP2, Anti-YAP65, Anti-Yes-associated protein 1, 65kDa
• Número MDL: MFCD04118707
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2F12, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): ELISA: suitable; immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_006106
• nº de adesão UniProt: P46937
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... YAP1(10413)

Descrição

Descrição geral

This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. (provided by RefSeq)

Yes-associated protein 1 (YAP1) is a transcriptional coactivator. It possesses two WW domains, a TID domain (TEA domain family member 1 transcription factor interacting-domain), sarcoma homology 3 domain (SH3) binding motif, a proline rich region and a PDZ motif. It is expressed in eight isoforms. The YAP1 gene is localized on human chromosome 11q22.1.

Imunogênio

YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR

Aplicação

Monoclonal Anti-YAP1 antibody produced in mouse has been used in western blotting and co-immunoprecipitation.

Ações bioquímicas/fisiológicas

Yes-associated protein 1 (YAP1) promotes cell and tissue growth. It interacts with receptor tyrosine-protein kinase (ErbB4) receptor and regulates transcription. YAP1 is an oncogenic protein and contributes to tumor progression. It is highly expressed in hedgehog-associated medulloblastomas and mutations in YAP1 is also implicated in optic fissure closure defects. Knockdown of YAP1 gene has been shown to lead to apoptosis of prostate cancer cells and is considered as a potential target for treatment.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)