WH0009735M1

Monoclonal Anti-KNTC1 antibody produced in mouse

clone 10H4, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-KIAA0166, Anti-ROD, Anti-kinetochore associated 1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 10H4, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_014708
• nº de adesão UniProt: P50748
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... KNTC1(9735)

Descrição

Descrição geral

This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. (provided by RefSeq)

Imunogênio

KNTC1 (NP_055523, 2100 a.a. ~ 2209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS

Ações bioquímicas/fisiológicas

KNTC1 (kinetochore associated 1) is part of the RZZ (Rod–Zw10–Zwilch) complex which is needed for proper kinetochore recruitment. Absence of KNTC1 causes checkpoint failure and early exit from mitosis.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)