Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

WH0006334M4

Sigma-Aldrich

Monoclonal Anti-SCN8A antibody produced in mouse

clone 4G7, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-MED, Anti-Nav1.6, Anti-sodium channel, voltage gated, type VIII, alpha

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

4G7, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

rat, mouse, human

técnica(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão GenBank

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SCN8A(6334)

Descrição geral

Sodium voltage-gated channel αsubunit 8 (SCN8A) is expressed in the central nervous system. The protein is specifically expressed in the axonal initial segment (AIS) and the nodes of Ranvier of myelinated axons. The gene encoding SCN8A is localized on human chromosome 12q13.13.

Imunogênio

SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT

Ações bioquímicas/fisiológicas

Sodium voltage-gated channel αsubunit 8 (SCN8A) has a role in the generation and conduction of action potential. Mutations in the SCN8A gene have been associated with early infantile epileptic encephalopathy type 13.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Sodium channel SCN8A (Nav1.6): properties and de novo mutations in epileptic encephalopathy and intellectual disability.
O'Brien JE and Meisler MH
Frontiers in Genetics (2013)
SCN8A mutations in Chinese patients with early onset epileptic encephalopathy and benign infantile seizures.
Wang J
BMC Medical Genetics, 18(1), 104-104 (2017)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica