WH0007442M1

Monoclonal Anti-TRPV1 antibody produced in mouse

clone 1F5, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Trpv1 Antibody, Trpv1 Antibody - Monoclonal Anti-TRPV1 antibody produced in mouse, Anti-DKFZp434K0220, Anti-VR1, Anti-transient receptor potential cation channel, subfamily V, member 1
• Número MDL: MFCD02686673
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1F5, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão GenBank: NM_080706
• nº de adesão UniProt: Q8NER1
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TRPV1(7442)

Descrição

Descrição geral

The gene encoding transient receptor potential cation channel subfamily V member 1 (TRPV1) is mapped to human chromosome 17p13. It is a non-selective cation channel. The protein is expressed on airway nerve fibers. It is also strongly expressed in sensory neurons.

Imunogênio

TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ

Ações bioquímicas/fisiológicas

Transient receptor potential cation channel subfamily V member 1 (TRPV1) is a capsaicin receptor. It participates in pain perception. TRPV1 also modulates afferent signals and bronchoconstriction. In the brain, it regulates neuronal function, motor behaviour and neuroinflammation. Capsaicin plays an important role in the activation of TRPV1.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)