WH0006279M1

Monoclonal Anti-S100A8 antibody produced in mouse

clone 2H2, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-60B8AG, Anti-CAGA, Anti-CFAG, Anti-CGLA, Anti-CP10, Anti-L1Ag, Anti-MA387, Anti-MIF, Anti-MRP8, Anti-NIF, Anti-P8, Anti-S100 calcium binding protein A8 (calgranulin A)
• Código UNSPSC: 12352203
• NACRES: NA.43

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2H2, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: BC005928
• nº de adesão UniProt: P05109
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... S100A8(6279)

Descrição

Descrição geral

The gene S100A8 (S100 calcium-binding protein A8) is mapped to human chromosome 1q21. It is also known as myeloid-related protein 8 (MRP8) or calgranulin A. It is a small calcium-binding protein, which is strongly expressed in neutrophils. In presence of cell stimulation, it is also expressed in monocytes, macrophages, platelets and epithelial and endothelial cells. S100A8 protein is present as a homodimer as well as heterodimer. The protein has two EF-hand motifs and one high-affinity Ca²⁺ binding site.

Imunogênio

S100A8 (AAH05928.1, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Ações bioquímicas/fisiológicas

S100A8 (S100 calcium-binding protein A8) is mainly present at the inflammation site or in the serum during acute and chronic inflammation. It is responsible for neutrophil recruitment, attachment and release from the bone marrow. S100A8 is crucial for sending neutrophils to the site of inflammation in the presence of bacterial infection, lipopolysaccharide and monosodium urate crystals. The protein is also involved in granulocyte and monocyte attachment to endothelium and also their transport across endothelial cells. The S100A8/A9 heterodimer induces monocyte migration and cytokine secretion. In the presence of falciparum malaria, high levels of S100A8 are present in the blood.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)