Pular para o conteúdo
Merck
Todas as fotos(6)

Documentos Principais

HPA024372

Sigma-Aldrich

Anti-S100A8 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-CFAG, Anti-Calgranulin-A, Anti-Calprotectin L1L subunit, Anti-Cystic fibrosis antigen, Anti-Leukocyte L1 complex light chain, Anti-MRP-8, Anti-Migration inhibitory factor-related protein 8, Anti-P8, Anti-Protein S100-A8, Anti-S100 calcium-binding protein A8

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:2500-1:5000

sequência de imunogênio

LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... S100A8(6279)

Descrição geral

The gene S100A8 (S100 calcium-binding protein A8) is mapped to human chromosome 1q21. It is a small calcium-binding protein, which is strongly expressed in neutrophils. In presence of cell stimulation, it is also expressed in monocytes, macrophages, platelets and epithelial and endothelial cells. S100A8 protein is present as a homodimer as well as heterodimer (S100A8/A9). The protein has two EF-hand motifs and one high-affinity Ca2+ binding site. S100A8 is also referred to as myeloid-related protein 8 (MRP8) or calgranulin A.

Imunogênio

Protein S100-A8 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-S100A8 antibody produced in rabbit has been used in immunohistochemistry and immunofluorescence.

Ações bioquímicas/fisiológicas

S100A8 (S100 calcium-binding protein A8) is mainly present at the inflammation site or in the serum during acute and chronic inflammation. It is responsible for neutrophil recruitment, attachment and release from the bone marrow. S100A8 is required for sending neutrophils to the site of inflammation in presence of bacterial infection, lipopolysaccharide, and monosodium urate crystals. It is also involved in granulocyte and monocyte attachment to endothelium and also their transport across endothelial cells. The S100A8/A9 heterodimer induces monocyte migration and cytokine secretion. In presence of falciparum malaria, high levels of S100A8 are present in the blood.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70709

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Gabriella Béke et al.
Frontiers in immunology, 9, 424-424 (2018-03-21)
The immunological barrier of the healthy skin is considered to be unified on the whole body surface-however, recent indirect findings have challenged this dogma since microbial and chemical milieu (e.g., sebum, sweat, and pH) exhibit remarkable differences on topographically distinct
Up-regulated S100 calcium binding protein A8 in Plasmodium-infected patients correlates with CD4(+)CD25(+)Foxp3 regulatory T cell generation.
Kim TS, et al.
Malaria Journal, 14, 385-385 (2015)
mRNA Expression of S100A8 as a Prognostic Marker for Progression of Non-Muscle-Invasive Bladder Cancer.
Ha YS, et al.
Korean Journal of Urology, 51, 15-20 (2010)
Secretion of S100A8, S100A9, and S100A12 by Neutrophils Involves Reactive Oxygen Species and Potassium Efflux.
Tardif MR, et al.
Journal of immunology research, 296149-296149 (2015)
Zhiwei Sun et al.
Cell death & disease, 11(8), 650-650 (2020-08-20)
Metastasis is the main cause of failure of cancer treatment. Metastatic colonization is regarded the most rate-limiting step of metastasis and is subjected to regulation by a plethora of biological factors and processes. On one hand, regulation of metastatic colonization

Global Trade Item Number

SKUGTIN
HPA024372-100UL4061837127120
HPA024372-25UL4061842844807

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica