Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

WH0004656M1

Sigma-Aldrich

Monoclonal Anti-MYOG antibody produced in mouse

clone 2B7, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-MYF4, Anti-MYOGENIN, Anti-myogenin (myogenic factor 4)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(4)

About This Item

Número MDL:
MFCD01322371
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

2B7, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

nº de adesão GenBank

BC053899

nº de adesão UniProt

P15173

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... MYOG(4656)

Descrição geral

Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. (provided by RefSeq)
MYOG (myogenin) is one of the muscle regulatory factors that belong to the b-HLH transcription factors family. This gene is located on human chromosome 1q32.1.

Imunogênio

MYOG (AAH53899, 1 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

Ações bioquímicas/fisiológicas

MYOG (myogenin) helps in the determination of skeletal muscle. It promotes myoblast differentiation. Myog, along with Myod is involved in a feed-forward circuit, which may help in patterning the muscle gene expression.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

recomendado

Nº do produto
Descrição
Preços

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
06083-2B7

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Copy Number Variation Analysis in 98 Individuals with PHACE Syndrome.
Siegel DH, et al.
The Journal of Investigative Dermatology, 133(3), 677-684 (2013)
Induced early expression of mrf4 but not myog rescues myogenesis in the myod/myf5 double-morphant zebrafish embryo.
Schnapp E, et al.
Journal of Cell Science, 122, 481-488 (2009)
L Chen et al.
The Journal of international medical research, 39(2), 378-387 (2011-06-16)
Skeletal muscle denervation eventually causes atrophy as a result of interrupted nerve conduction and the lack of nutritional factors. Myogenin is a myogenic regulatory factor that plays a key role in myoblast differentiation. Changes in myogenin expression in denervated rat
Jens Isak Andersen et al.
Biochemical and biophysical research communications, 450(2), 1083-1088 (2014-07-06)
Although adult muscle tissue possesses an exceptional capacity for regeneration, in the case of large defects, the restoration to original state is not possible. A well-known source for the de novo regeneration is the adipose-derived stem cells (ASCs), which can
Ana C Calvo et al.
Aging and disease, 10(2), 278-292 (2019-04-24)
The identification of more reliable diagnostic or prognostic biomarkers in age-related neurodegenerative diseases, such as Amyotrophic Lateral Sclerosis (ALS), is urgently needed. The objective in this study was to identify more reliable prognostic biomarkers of ALS mirroring neurodegeneration that could
Exibir todos os documentos relacionados

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica