SAB2108745

Anti-KLF6

affinity isolated antibody

• Sinônimo(s): Anti- COPEB, Anti- CPBP, Anti- GBF, Anti-BCD1
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• clone: polyclonal
• reatividade de espécies: guinea pig, mouse, bovine, horse, rat, dog, human, rabbit
• citations: 1
• técnica(s): immunoblotting: suitable

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 32 kDa
• reatividade de espécies: guinea pig, mouse, bovine, horse, rat, dog, human, rabbit
• concentração: 0.5-1 mg/mL
• técnica(s): immunoblotting: suitable
• nº de adesão: NM_001300
• nº de adesão UniProt: Q99612
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... KLF6(1316)

Descrição

Imunogênio

Synthetic peptide directed towards the N terminal region of human KLF6

Ações bioquímicas/fisiológicas

KLF6 is a nuclear protein that has three zinc fingers at the end of its C-terminal domain, a serine/threonine-rich central region, and an acidic domain lying within the N-terminal region. The zinc fingers of this protein are responsible for the specific DNA binding with the guanine-rich core promoter elements. The central region might be involved in activation or posttranslational regulatory pathways, and the acidic N-terminal domain might play an important role in the process of transcriptional activation. It is capable of activating transcription approximately 4-fold either on homologous or heterologous promoters. KLF6 may participate in the regulation and/or maintenance of the basal expression of pregnancy-specific glycoprotein genes and possibly other TATA box-less genes.This gene encodes a nuclear protein that has three zinc fingers at the end of its C-terminal domain, a serine/threonine-rich central region, and an acidic domain lying within the N-terminal region. The zinc fingers of this protein are responsible for the specific DNA binding with the guanine-rich core promoter elements. The central region might be involved in activation or posttranslational regulatory pathways, and the acidic N-terminal domain might play an important role in the process of transcriptional activation. It is capable of activating transcription approximately 4-fold either on homologous or heterologous promoters. The DNA binding and transcriptional activity of this protein, in conjunction with its expression pattern, suggests that this protein may participate in the regulation and/or maintenance of the basal expression of pregnancy-specific glycoprotein genes and possibly other TATA box-less genes. Two transcript variants encoding the same protein have been found for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-731 BM544849.1 20-750 732-1504 BC000311.2 669-1441 1505-1598 BC004301.1 1440-1533

Sequência

Synthetic peptide located within the following region: REKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable