Pular para o conteúdo
Merck
Todas as fotos(2)

Key Documents

SAB1410166

Sigma-Aldrich

Anti-NUDT5 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

YSA1, YSA1H, hYSAH1

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

antigen 24.3 kDa

reatividade de espécies

human

técnica(s)

immunofluorescence: suitable
western blot: 1 μg/mL

nº de adesão NCBI

NM_014142.2

nº de adesão UniProt

Q9UKK9

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... NUDT5(11164)

Descrição geral

Nudix hydrolases, such as NUDT5, eliminate toxic nucleotide derivatives from the cell and regulate the levels of important signaling nucleotides and their metabolites (McLennan, 1999 [PubMed 10373642]).[supplied by OMIM

Imunogênio

NUDT5 (NP_054861.2, 1 a.a. ~ 219 a.a) full-length human protein.

Sequence
MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Ações bioquímicas/fisiológicas

NUDT5 (Nudix, nucleoside diphosphate linked moiety X-type motif 5) is mainly involved in maintaining the intracellular level of ADP-ribose by hydrolyzing ADP-ribose (ADPR) to AMP and ribose 5′-phosphate. It also restricts non-enzymatic ADP-ribosylation. Its N-terminal antiparallel β-sheet plays an important role in dimerization, which is essential for substrate recognition and enzymatic activity. NUDT5 has also been predicted for altered cell proliferation. It has been suggested that cells with suppressed NUDT5 shows delayed cell cycle G1 phase. Thus, it has been concluded that NUDT5 may involve in cell growth and cell cycle proliferation by regulating G1-S transition in mammalian cells.

forma física

Solution in phosphate buffered saline, pH 7.4

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Hong-Nu Yu et al.
Biochemical and biophysical research communications, 354(3), 764-768 (2007-01-31)
The ADP-ribose (ADPR) pyrophosphatase (ADPRase) NUDT5, a member of a superfamily of Nudix hydrolases, hydrolyzes ADP-ribose (ADPR) to AMP and ribose 5'-phosphate. Nitric oxide (NO) enhances nonenzymatic ADP-ribosylation of proteins such as beta-actin and glyceraldehydes 3-phosphate dehydrogenase in the presence
Li-Qun Zhang et al.
Molecular and cellular biochemistry, 363(1-2), 377-384 (2011-12-28)
The molecule 8-oxo-7,8-dihydroguanine (8-oxoGua), an oxidized form of guanine, can pair with adenine or cytosine during nucleic acid synthesis. Moreover, RNA containing 8-oxoGua causes translational errors, thus leading to the production of abnormal proteins. Human NUDT5, a MutT-related protein, catalyzes
Manwu Zha et al.
Journal of molecular biology, 364(5), 1021-1033 (2006-10-21)
Human NUDT5 (hNUDT5) is an ADP-ribose pyrophosphatase (ADPRase) belonging to the Nudix hydrolase superfamily. It presumably plays important roles in controlling the intracellular level of ADP-ribose (ADPR) to prevent non-enzymatic ADP-ribosylation by hydrolyzing ADPR to AMP and ribose 5'-phosphate. We

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica