SAB1410147

Anti-RAB32 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: antigen 24.75 kDa
• reatividade de espécies: human
• técnica(s): western blot: 1 μg/mL
• nº de adesão NCBI: NM_006834.1
• nº de adesão UniProt: Q13637
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... RAB32(10981)

Descrição

Descrição geral

Small GTP-binding proteins of the RAB family, such as RAB32, play essential roles in vesicle and granule targeting (Bao et al., 2002 [PubMed 11784320]).[supplied by OMIM

Imunogênio

RAB32 (NP_006825.1, 1 a.a. ~ 225 a.a) full-length human protein.

Sequence
MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC

Ações bioquímicas/fisiológicas

RAB32 (Ras-related protein) controls intracellular lipid accumulation in hepatocytes. Absence of it promotes the expression of ATGL (adipose triglyceride lipase) and thereby causes lipolysis. RAB32 is involved in hepatic steatosis. In melanogenesis, it is involved in the transport of important enzymes, such as tyrosinase and Tyrp1 (tyrosinase related protein 1). RAB32 also interacts with and is involved in localization of leucine-rich repeat kinase 2 (LRRK2), a protein associated with Parkinson′s disease. RAB32 is hypermethylated in microsatellite-unstable colon, gastric and endometrial adenocarcinomas.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable