WH0000834M1

Monoclonal Anti-CASP1 antibody produced in mouse

clone 3D2, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-ICE, Anti-IL1BC, Anti-P45, Anti-caspase 1, apoptosis-related cysteine protease (interleukin 1, beta, convertase)
• Número MDL: MFCD00283496
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3D2, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: BC062327
• nº de adesão UniProt: P29466
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CASP1(834)

Descrição

Descrição geral

The caspase-1 (CASP1) /interleukin-1β converting enzyme (ICE) gene, with ten exons, is mapped to human chromosome 11q22.2. The encoded protein contains an N-terminal CARD (caspase activation and recruitment domain), a large P20 subunit and a small P10 subunit. CASP1 is distributed in leukocytes, monocytes and epithelial cells.

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms. (provided by RefSeq)

Imunogênio

CASP1 (AAH62327, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL

Ações bioquímicas/fisiológicas

Caspase-1 has an ability to transform pro-inflammatory cytokines, interleukin-1 β (IL-1 β) and IL-18 into their active forms. In addition, it also participates in pyroptosis. Elevated expression of the gene has been observed in the aorta of coronary atherosclerosis patients. CASP1 helps in host cell survival by inducing membrane biogenesis to restore the impairment caused by pore-forming toxins.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)