SAB1408981

Monoclonal Anti-ERCC2 antibody produced in mouse

clone 2C9, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): COFS2, EM9, MGC102762, MGC126218, MGC126219, TTD, XPD
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2C9, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen 36.74 kDa
• reatividade de espécies: human
• técnica(s): immunofluorescence: suitable; indirect ELISA: suitable
• Isotipo: IgG2bκ
• nº de adesão NCBI: NM_000400
• nº de adesão UniProt: P18074
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ERCC2(2068)

Descrição

Descrição geral

The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Imunogênio

ERCC2 (NP_000391, 631 a.a. ~ 730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHR

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable