SAB1405525
Anti-TSPO antibody produced in mouse
purified immunoglobulin, buffered aqueous solution
Sinônimo(s):
BZRP, DBI, IBP, MBR, PBR, PKBS, PTBR, TSPO Antibody - Anti-TSPO antibody produced in mouse, Tspo Antibody, mDRC, pk18
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
mouse
conjugado
unconjugated
forma do anticorpo
purified immunoglobulin
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
forma
buffered aqueous solution
peso molecular
antigen ~18.8 kDa
reatividade de espécies
human
técnica(s)
western blot: 1 μg/mL
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
dry ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... TSPO(706)
Categorias relacionadas
Descrição geral
Translocator protein (TSPO) contains five α helices. The TSPO gene is mapped to human chromosome 22q13.2. It is expressed in activated microglia.
Imunogênio
TSPO (AAH01110.1, 1 a.a. ~ 169 a.a) full-length human protein.
Sequence
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Sequence
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Aplicação
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Flow cytometry/Cell sorting (1 paper)
Flow cytometry/Cell sorting (1 paper)
Ações bioquímicas/fisiológicas
Translocator protein (TSPO) serves as a marker for microglial activation. The levels of TSPO are elevated in multiple sclerosis, Huntington′s disease (HD), and brain ischemia as well as in gliomas. TSPO functions as a key target for understanding neuroinflammation and has applications in positron emission tomography (PET) imaging. It also binds to cholesterol. The TSPO gene polymorphism may be associated with the pathophysiology of panic attacks, bipolar disorder, and anxiety. Together with voltage-dependent anion channel (VDAC), TSPO regulates terminal erythropoiesis as well as autophagy in mitochondria.
forma física
Solution in phosphate buffered saline, pH 7.4
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Aniello DE Rosa et al.
Oncology letters, 9(3), 1327-1332 (2015-02-11)
Principally located in the outer mitochondrial membrane, the translocator protein (TSPO) is an 18-kDa transmembrane protein that is a key component of the mitochondrial permeability transition pore. TSPO is associated with a number of biological processes, including apoptosis, the regulation
Laura Airas et al.
Clinical and translational imaging, 3, 461-473 (2015-01-01)
Conventional MR imaging (MRI) techniques form the cornerstone of multiple sclerosis (MS) diagnostics and clinical follow-up today. MRI is sensitive in demonstrating focal inflammatory lesions and diffuse atrophy. However, especially in progressive MS, there is increasingly widespread diffuse pathology also
Biljana Musicki et al.
Journal of cellular physiology, 236(4), 3073-3082 (2020-09-26)
Priapism, a prolonged penile erection in the absence of sexual arousal, is common among patients with sickle cell disease (SCD). Hypogonadism is also common in patients with SCD. While the administration of exogenous testosterone reverses hypogonadism, it is contraceptive. We
Xiaoming Liu et al.
The Journal of steroid biochemistry and molecular biology, 143, 130-140 (2014-03-13)
Although progesterone was reported to be a neuroprotective agent against injuries to the nervous system, including the peripheral neuropathy, the mechanisms of its dose or timing-related effects remain unclear. Translocator protein (TSPO) is predominantly located in the mitochondrial outer membrane
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica