MSST0040

SILu^™Lite IFNG Interferon Gamma human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Sinônimo(s): IFNγ, IFN-gamma, Immune interferon, Immuneinterferon
• Código UNSPSC: 23201100
• NACRES: NA.12

Propriedades

• fonte biológica: human
• Nível de qualidade: 200
• recombinante: expressed in HEK 293 cells
• Ensaio: ≥98% (SDS-PAGE)
• Formulário: lyophilized powder
• potência: ≥98% Heavy amino acids incorporation efficiency by MS
• peso molecular: calculated mol wt 17 kDa
• técnica(s): mass spectrometry (MS): suitable
• adequação: suitable for mass spectrometry (internal calibrator)
• nº de adesão UniProt: P01579
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... IFNG(3458)

Descrição

Descrição geral

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

Imunogênio

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Ações bioquímicas/fisiológicas

SILu^™Lite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

forma física

Lyophilized from a solution of phosphate buffered saline.

Informações legais

SILu is a trademark of Sigma-Aldrich Co. LLC

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable