MSST0039

SILu^™Prot IFNG Interferon Gamma human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Sinônimo(s): IFNγ, IFN-gamma, IFNG mass-spectrometry standard, Immune interferon, Immuneinterferon, Interferon-gamma mass-spectrometry standard, stable isotope-labeled human IFNG
• Código UNSPSC: 23201100
• NACRES: NA.12

Propriedades

• fonte biológica: human
• Nível de qualidade: 200
• recombinante: expressed in HEK 293 cells
• Ensaio: ≥98% (SDS-PAGE)
• Formulário: lyophilized powder
• potência: ≥98% Heavy amino acids incorporation efficiency by MS
• peso molecular: calculated mol wt 17 kDa
• técnica(s): mass spectrometry (MS): suitable
• adequação: suitable for mass spectrometry (standard)
• nº de adesão UniProt: P01579
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... IFNG(3458)

Descrição

Descrição geral

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

Imunogênio

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Ações bioquímicas/fisiológicas

SILu^™Prot IFNG is a recombinant, stable isotope-labeled human IFNG which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IFNG in mass-spectrometry. SILu Prot IFNG is a homodimer consisting of 138 amino acids, with a calculated molecular mass of 17 kDa.

forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Informações legais

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable