HPA007875
Anti-MMP3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
Anti-MMP-3 antibody produced in rabbit, Anti-Matrix metalloproteinase-3 antibody produced in rabbit, Anti-SL-1 antibody produced in rabbit, Anti-Stromelysin-1 precursor antibody produced in rabbit, Anti-Transin-1 antibody produced in rabbit
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.43
Produtos recomendados
fonte biológica
rabbit
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
forma
buffered aqueous glycerol solution
reatividade de espécies
human
validação aprimorada
recombinant expression
Learn more about Antibody Enhanced Validation
técnica(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
sequência de imunogênio
MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... MMP3(4314)
Descrição geral
MMP3 (matrix metallopeptidase 3) gene is a part of a gene cluster that encodes matrix metalloproteinases (MMP) and is localized to human chromosome 11q22.3. MMPs are a family of 23 members that are induced by the cytokine tumor necrosis factor (TNF)-α. These proteinases are secreted in an inactive form and are activated upon cleavage by certain proteinases.
Imunogênio
Stromelysin-1 precursor recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-MMP3 antibody produced in rabbit has been used for global protein profiling to find new molecular biomarkers for common, multifactorial disorders.
Anti-MMP3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Anti-MMP3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Ações bioquímicas/fisiológicas
Matrix metallopeptidase 3 (MMP3) has a broad substrate specificity and is capable of degrading fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. This enzyme functions is several physiological processes, such as in wound repair, progression of atherosclerosis, tissue remodeling and tumor initiation. MMP3 variant can be associated with hypertrophy of interventricular septum or hypertrophic cardiomyopathy. It may serves as a non-invasive biomarker of histological synovitis and diagnosis of rheumatoid arthritis.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST70114
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Jian-Da Ma et al.
Mediators of inflammation, 2014, 179284-179284 (2014-08-26)
To explore the correlation between matrix metalloproteinase- (MMP-) 3 and histological synovitis in rheumatoid arthritis (RA). Serum MMP-3 of 62 patients with active RA was detected by ELISA. Serial synovial tissue sections from all RA patients, 13 osteoarthritis, and 10
Minna Piipponen et al.
The American journal of pathology, 190(2), 503-517 (2019-12-16)
Long noncoding RNAs (lncRNAs) have emerged as putative biomarkers and therapeutic targets in cancer. The role of lncRNA LINC00346 in cutaneous squamous carcinoma (cSCC) was examined. The expression of LINC00346 was up-regulated in cSCC cells compared with normal human epidermal
E V Privalova et al.
Kardiologiia, 54(5), 4-7 (2014-09-02)
Prognosis of patients with hypertrophic cardiomyopathy (HCMP) to a great extent is determined by clinical variant of the disease. As the system of matrix metalloproteinases (MMPs) plays an important role in development and progression of the processes of fibroformation and
Magnus S Ågren et al.
European journal of cell biology, 94(1), 12-21 (2014-12-03)
Tumor necrosis factor (TNF)-α induces matrix metalloproteinases (MMPs) that may disrupt skin integrity. We have investigated the effects and mechanisms of exogenous TNF-α on collagen degradation by incubating human skin explants in defined serum-free media with or without TNF-α (10ng/ml)
Jun-Jie Chen et al.
Asian Pacific journal of tropical medicine, 7(4), 297-300 (2014-02-11)
To investigate the expression and significance of MMP-3 in synovium of knee joint at different stage in osteoarthritis (OA) patients. Knee synovial tissue were collected in 90 OA patients (the OA group). Patients in the OA group was divided into
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica