HPA006641

Anti-SCGN antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-Secretagogin antibody produced in rabbit
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA006641
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry: 1:500-1:1000; western blot: 0.04-0.4 μg/mL
• sequência de imunogênio: RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK
• nº de adesão UniProt: O76038
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SCGN(10590)

Descrição

Descrição geral

SCGN (Secretagogin) is a novel EF-hand, cell type specific, Ca-binding protein (CBP). It is expressed in the neuroendocrine cells. Specifically, its expression has been reported in the (entero)-endocrine cells and in neuroendocrine cells in the periphery and in the mammalian brain. It is involved in the regulation of intracellular Ca²⁺ dynamics. It contains a Ca²⁺ binding domain and six putative EF hand motifs.

Imunogênio

Secretagogin recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-SCGN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Ações bioquímicas/fisiológicas

SCGN (Secretagogin) is mainly acting as a calcium ion sensor in the Ca²⁺-induced exocytosis and membrane fusion in neurons and in neuroendocrine cells. It can bind four Ca²⁺ ions, but interacts with only one SCGN interacting protein. It acts as a serum marker for identifying neuronal damage. It has been reported that SCGN may control the intracellular Ca²⁺ signaling pathway by reflecting cellular responses to the micro-environmental stimuli. Furthermore, neuroprotective effects of SCGN also have been documented in the Alzheimer′s disease.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST86799

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)