Pular para o conteúdo
Merck
Todas as fotos(2)

Key Documents

AV51319

Sigma-Aldrich

Anti-GP1BA antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-BSS, Anti-CD42B, Anti-CD42b-α+F12935, Anti-GP1B, Anti-Glycoprotein Ib (platelet), α polypeptide, Anti-MGC34595

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

68 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_000164

nº de adesão UniProt

P07359

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... GP1BA(2811)

Categorias relacionadas

Imunogênio

Synthetic peptide directed towards the C terminal region of human GP1BA

Aplicação

Anti-GP1BA antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Ações bioquímicas/fisiológicas

Glycoprotein Ib (GP1BA) is a membrane glycoprotein present on the surface of platelets. It acts as the receptors for von Willebrand factor that facilitates the adhesion of platelets to vascular subendothelium after vascular injury, thrombosis, platelet activation and hemostasis. Mutations in GP1BA are associated with Bernard-Soulier syndromes and platelet-type von Willebrand disease.

Sequência

Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Maha Othman et al.
Seminars in thrombosis and hemostasis, 39(6), 663-673 (2013-08-13)
Compared with coagulation factor defects, little attention is given to defects of platelet function as causes of rare bleeding disorders. Platelet-type von Willebrand disease (PT-VWD) is an autosomal dominant bleeding disorder and is unique among platelet disorders because it is
Naomasa Yamamoto et al.
Thrombosis research, 131(4), e160-e167 (2013-02-19)
A defective platelet glycoprotein (GP) Ib/IX/V complex [von Willebrand factor (VWF) receptor] results in Bernard-Soulier syndrome (BSS), which is characterized by macrothrombocytopenia and impaired ristocetin- and thrombin-induced platelet aggregation. We found 2 independent BSS-variant families: Case I [compound heterozygous mutations
Sayer I Al-Azzam et al.
Gene, 526(2), 118-121 (2013-05-22)
Aspirin is an antiplatelet agent commonly used in treatment of patients with high risk to develop stroke and myocardial infarction. However, inter-individual variability regarding the inhibition of platelet function by aspirin is well documented. In this study, the correlation between

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica