Pular para o conteúdo
Merck
Todas as fotos(1)

Key Documents

AV50793

Sigma-Aldrich

Anti-ZMAT3 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-FLJ12296, Anti-MGC10613, Anti-PAG608, Anti-WIG-1, Anti-WIG1, Anti-Zinc finger, matrin type 3

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

32 kDa

reatividade de espécies

dog, rat, human, mouse, rabbit, guinea pig, horse, bovine

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_071915

nº de adesão UniProt

Q9HA38

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ZMAT3(64393)

Categorias relacionadas

Imunogênio

Synthetic peptide directed towards the N terminal region of human ZMAT3

Aplicação

Anti-ZMAT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Ações bioquímicas/fisiológicas

ZMAT3 is a p53 target gene that regulates cell growth and cell cycle progression by regulation of FAS and 14-3-3σ mRNA levels.

Sequência

Synthetic peptide located within the following region: EQDCALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSC

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

C Bersani et al.
Oncogene, 33(35), 4407-4417 (2014-01-29)
Wig-1, also known as ZMAT3, is a p53 target gene that encodes an RNA-binding zinc-finger protein involved in the regulation of mRNA stability through binding to AU-rich elements (AREs). We have used microarray analysis to identify novel Wig-1 target mRNAs.
Kaveh M Goudarzi et al.
Cancer biology & therapy, 15(11), 1499-1514 (2014-12-09)
Mechanistic target of rapamycin (mTOR) is a master regulator of cell growth through its ability to stimulate ribosome biogenesis and mRNA translation. In contrast, the p53 tumor suppressor negatively controls cell growth and is activated by a wide range of
Karl Holmberg Olausson et al.
The Journal of biological chemistry, 289(50), 34601-34619 (2014-10-29)
Nucleoli are prominent nuclear structures assembled and organized around actively transcribed ribosomal DNA (rDNA). The nucleolus has emerged as a platform for the organization of chromatin enriched for repressive histone modifications associated with repetitive DNA. NPM1 is a nucleolar protein

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica