AV48718

Anti-SDF2 antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-Stromal cell-derived factor 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 21 kDa
• reatividade de espécies: horse, rabbit, mouse, dog, bovine, human, guinea pig, rat
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_008854
• nº de adesão UniProt: Q99470
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SDF2(6388)

Descrição

Descrição geral

SDF2 codes for stromal cell-derived factor 2 that functions as a secretory protein. Studies in Arabidopsis have revealed that SDF2 regulates unfolded protein response in the endoplasmic reticulum.
Rabbit Anti-SDF2 antibody recognizes bovine, human, mouse, rat, and zebrafish SDF2.

Imunogênio

Synthetic peptide directed towards the N terminal region of human SDF2

Aplicação

Rabbit Anti-SDF2 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml and for IHC at 4-8 μg/ml.

Ações bioquímicas/fisiológicas

SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.

Sequência

Synthetic peptide located within the following region: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable