AV46079

Anti-PPAT antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-ATASE, Anti-GPAT, Anti-PRAT, Anti-Phosphoribosyl pyrophosphate amidotransferase
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 56 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_002694
• nº de adesão UniProt: Q06203
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PPAT(5471)

Descrição

Descrição geral

Phosphoribosyl pyrophosphate amidotransferase/glutamine phosphoribosyl pyrophosphate amidotransferase (PPAT, PRAT, ATASE, GPAT) catalyzes the first committed step in de novo purine biosynthesis by converting α-phosphoribosylpyrophosphate (α-PRPP) into 5-β-phosphoribosylamine. Phosphoribosylamine (PRA) is the first intermediate in the common purine/thiamine biosynthetic pathway.

Especificidade

Anti-PPAT polyclonal antibody reacts with bovine, rat, canine, and human phosphoribosyl pyrophosphate amidotransferase/glutamine phosphoribosyl pyrophosphate amidotransferase enzymes.

Imunogênio

Synthetic peptide directed towards the N terminal region of human PPAT

Aplicação

Anti-PPAT polyclonal antibody is used to tag phosphoribosyl pyrophosphate amidotransferase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of phosphoribosyl pyrophosphate amidotransferase in purine/pyrimidine biosynthesis.

Ações bioquímicas/fisiológicas

PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Sequência

Synthetic peptide located within the following region: VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable