Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV44535

Sigma-Aldrich

Anti-SDCBP antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-MDA-9, Anti-ST1, Anti-SYCL, Anti-Syndecan binding protein (syntenin), Anti-TACIP18

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

32 kDa

reatividade de espécies

human, rat, rabbit, guinea pig, horse, mouse, bovine, dog

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_001007068

nº de adesão UniProt

O00560

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SDCBP(6386)

Imunogênio

Synthetic peptide directed towards the middle region of human SDCBP

Aplicação

Anti-SDCBP antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Ações bioquímicas/fisiológicas

Syndecan binding protein (SDCBP; syntenin, mda-9) is a scaffolding protein containing a PDZ domain that has functions that include cell adhesion, proliferation, protein trafficking, cytoskeletal organization and activation of transcription factors. It promotes metastasis of cancer cells by activating FAK, NF-κB, c-Src and p38-MAPK pathways.

Sequência

Synthetic peptide located within the following region: VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC14970

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Habib Boukerche et al.
Cancer research, 67(4), 1812-1822 (2007-02-20)
mda-9/Syntenin is a scaffolding PDZ domain-containing protein overexpressed in multiple human cancers that functions as a positive regulator of melanoma metastasis. Using a normal immortal human melanocyte cell line and weakly and highly metastatic human melanoma cell lines, we presently
Habib Boukerche et al.
Proceedings of the National Academy of Sciences of the United States of America, 105(41), 15914-15919 (2008-10-04)
The scaffold PDZ-domain containing protein mda-9/syntenin functions as a positive regulator of cancer cell progression in human melanoma and other tumors. mda-9/Syntenin regulates cell motility and invasion by altering defined biochemical and signaling pathways, including focal adhesion kinase (FAK), p38
Devanand Sarkar et al.
Cancer research, 68(9), 3087-3093 (2008-05-03)
Cancer is a progressive disease that, in many instances, if untreated, can culminate in metastatic spread of primary tumor cells to distant sites in the body. Metastasis frequently confers virulence and therapy resistance to cancer cells, and defining the molecular
Xiao-Long Qian et al.
PloS one, 8(3), e60046-e60046 (2013-03-28)
Syndecan binding protein (SDCBP), an adapter protein containing PDZ domains, contributes to the tumorigenicity and metastasis of many malignant tumors, such as malignant melanoma. Our study aimed in revealing the expression profile of SDCBP in breast cancer (BCa) and its

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica