AV35458

Anti-KCNQ2 (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-BFNC, Anti-EBN, Anti-EBN1, Anti-ENB1, Anti-HNSPC, Anti-KCNA11, Anti-KV7.2, Anti-Potassium voltage-gated channel, KQT-like subfamily, member 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 44 kDa
• reatividade de espécies: rat, bovine, horse, mouse, human, dog, guinea pig
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_004509
• nº de adesão UniProt: Q53Y30
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... KCNQ2(3785)

Descrição

Imunogênio

Synthetic peptide directed towards the N terminal region of human KCNQ2

Ações bioquímicas/fisiológicas

The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by KCNQ2 and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by this gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in this gene are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1). At least five transcript variants encoding five different isoforms have been found for this gene.

Sequência

Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable