AV33271

Anti-SOX17 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-SRY (sex determining region Y)-box 17
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 44 kDa
• reatividade de espécies: human, pig, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_071899
• nº de adesão UniProt: Q9H6I2
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SOX17(64321)

Descrição

Descrição geral

SRY-box (SOX) transcription factors bind the minor groove of DNA to modulate gene expression. SRY-box 17 (SOX17) regulates a variety of developmental processes such as endoderm formation. SOX17 is an antagonist to Wnt/β-catenin pathway cell signaling. SOX17 is a potential biomarker for breast cancer carcinogenesis and progression.

Especificidade

Rabbit polyclonal anti-SOX17 antibody reacts with canine, human, and pig SRY (sex determining region Y)-box 17 transcription factors.

Imunogênio

Synthetic peptide directed towards the C terminal region of human SOX17

Ações bioquímicas/fisiológicas

The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.

Sequência

Synthetic peptide located within the following region: GTDPSQPAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGA

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable