AV32784

Anti-ACSL1 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-ACS1, Anti-Acyl-CoA synthetase long-chain family member 1, Anti-FACL1, Anti-FACL2, Anti-LACS, Anti-LACS1, Anti-LACS2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 78 kDa
• reatividade de espécies: human, mouse, rat
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_001986
• nº de adesão UniProt: P33121
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ACSL1(2180)

Descrição

Descrição geral

ACSL1 is an isozyme that belongs to the long-chain fatty-acid-coenzyme A ligase family. This enzyme converts free long-chain fatty acids into fatty acyl-CoA esters. Thus, it regulates lipid synthesis and fatty acid breakdown. Studies in bovine mammary glands have reported that ACSL1 modulates the channelling of fatty acids towards milk fat formation.
Rabbit Anti-ACSL1 (AB1) antibody recognizes pig, bovine, zebrafish, human, mouse, rat, and canine ACSL1.

Imunogênio

Synthetic peptide directed towards the C terminal region of human ACSL1

Aplicação

Rabbit Anti-ACSL1 (AB1) antibody can be used for western blot applications at a concentration of 1 μg/ml.

Ações bioquímicas/fisiológicas

ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequência

Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable