AV30475
Anti-BCL2L1 antibody produced in rabbit
IgG fraction of antiserum
Sinônimo(s):
Anti-BCL-XL/S, Anti-BCL2-like 1, Anti-BCL2L, Anti-BCLX, Anti-Bcl-X, Anti-Bcl-xL, Anti-Bcl-xS, Anti-DKFZp781P2092
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
IgG fraction of antiserum
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
buffered aqueous solution
peso molecular
26 kDa
reatividade de espécies
sheep, rabbit, horse, pig, human, bovine, dog
concentração
0.5 mg - 1 mg/mL
técnica(s)
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... BCL2L1(598)
Categorias relacionadas
Descrição geral
BCL2L1 is a signaling molecule that is known to regulate neuronal apoptosis. Furthermore, BCL2L1 can facilitate the survival of retinal ganglion cells.
Rabbit Anti-BCL2L1 associates with rabbit, rat, bovine, canine, pig, mouse, and human BCL2L1.
Rabbit Anti-BCL2L1 associates with rabbit, rat, bovine, canine, pig, mouse, and human BCL2L1.
Imunogênio
Synthetic peptide directed towards the N terminal region of human BCL2L1
Aplicação
Rabbit Anti-BCL2L1 antibody can be used for western blot (2.5μg/ml) assays.
Ações bioquímicas/fisiológicas
BCL2L1 encodes a protein which belongs to the BCL-2 protein family. The proteins encoded by BCL2L1 are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis.The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported. The longer isoform acts as an apoptotic inhibitor and the shorter form acts as an apoptotic activator.
Sequência
Synthetic peptide located within the following region: SNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAING
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Joanna Janisiak et al.
International journal of molecular sciences, 22(15) (2021-08-08)
Rhabdomyosarcoma (RMS) is a malignant soft tissue cancer that develops mostly in children and young adults. With regard to histopathology, four rhabdomyosarcoma types are distinguishable: embryonal, alveolar, pleomorphic and spindle/sclerosing. Currently, increased amounts of evidence indicate that not only gene
Jeffrey M Harder et al.
Molecular and cellular neurosciences, 51(1-2), 53-59 (2012-07-28)
The Bcl-2 family is responsible for regulating cell death pathways in neurons during development, after injury and in disease. The activation of the pro-death family member BAX is often the final step before cell death in neurons. Pro-survival family members
Li Gao et al.
Hematology (Amsterdam, Netherlands), 19(3), 148-157 (2013-07-31)
Bone marrow stromal cells (BMSCs) can support multiple myeloma (MM) disease progression and resistance to chemotherapy. The proliferation of MM cells may be suppressed by modifying the hematopoietic microenvironment (HME). We have previously isolated human umbilical cord blood-derived stromal cells
W He et al.
Oncogene, 33(23), 3004-3013 (2013-07-09)
Killing cancer cells through the induction of apoptosis is one of the main mechanisms of chemotherapy. However, numerous cancer cells have primary or acquired apoptosis resistance, resulting in chemoresistance. In this study, using a novel chalcone derivative chalcone-24 (Chal-24), we
Yong Xin et al.
Molecular medicine reports, 10(3), 1569-1575 (2014-07-26)
High‑dose total body irradiation (TBI) has an established role as preparative regimen for bone‑marrow transplantation in the treatment of chronic myelogenous leukemia (CML), but this regimen still has a relatively high rate of acute and late toxicity. Low‑dose radiation (LDR)
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica