Pular para o conteúdo
Merck
Todas as fotos(10)

Documentos Principais

AMAB91130

Sigma-Aldrich

Anti-Choline Acetyltransferase Antibody

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, mouse monoclonal, CL3173

Sinônimo(s):

Anti-CHOACTASE, Anti-CMS1A, Anti-CMS1A2, Anti-CMS6

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.43

Nome do produto

Monoclonal Anti-CHAT antibody produced in mouse, Prestige Antibodies® Powered by Atlas Antibodies, clone CL3173, purified immunoglobulin, buffered aqueous glycerol solution

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

CL3173, monoclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

mouse, human, rat

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunofluorescence: 2-10 μg/mg (Fixation/Permeabilization: PFA/Triton X-100)
immunohistochemistry: 1:1000- 1:2500

Isotipo

IgG2b

sequência de imunogênio

GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CHAT(1103)

Categorias relacionadas

Descrição geral

Choline O-acetyltransferase (CHAT) gene is mapped to human chromosome 10q11.23. It has a choline binding domain pocket and a catalytic domain.

Imunogênio

choline O-acetyltransferase

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Ações bioquímicas/fisiológicas

Choline O-acetyltransferase (CHAT) enzyme mediates the synthesis of neurotransmitter, acetylcholine from choline and acetyl-CoA in cholinergic neurons. Phosphorylation at serine and threonine residues is critical for the function of CHAT. Mutations in the active site residues, results in loss of enzyme activity. Deletion in CHAT gene locus impacts neuromuscular signal transmission contributing to muscle weakness in congenital myasthenic syndromes. A mutation in the CHAT gene leads to choline acetyltransferase deficiency and triggers recurrent breathlessness in infants. Polymorphisms in CHAT is implicated in Alzheimer′s disease.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST74314

forma física

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Functional consequences and structural interpretation of mutations of human choline acetyltransferase
Shen Xm, et al.
Human Mutation, 32(11), 1259-1267 (2011)
Human choline acetyltransferase gene maps to region 10q11-q22. 2 by in situ hybridization
Strauss WL, et al.
Genomics, 9(2), 396-398 (1991)
Functional regulation of choline acetyltransferase by phosphorylation
Dobransky T and Rylett RJ
Neurochemical Research, 28(3-4), 537-542 (2003)
Association of Choline Acetyltransferase Gene Polymorphisms (SNPs rs868750G/A, rs1880676G/A, rs2177369G/A and rs3810950G/A) with Alzheimer?s Disease Risk: A Meta-Analysis
Yuan H, et al.
PLoS ONE, 11(7), e0159022-e0159022 (2016)
Congenital myasthenic syndrome associated with episodic apnea and sudden infant death
Byring RF, et al.
Neuromuscular Disorders, 12(6), 548-553 (2002)

Global Trade Item Number

SKUGTIN
AMAB91130-100UL4061837049378
AMAB91130-25UL4061841323082

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica