Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

View All Documentation

MSQC4

Sigma-Aldrich

SILu™Lite SigmaMAb Universal Antibody Standard human

Synonym(s):

IgG1 light, Mass Spectrometry Universal Antibody Standard, SILu™Lite SigmaMAb Universal Antibody Standard human, recombinant IgG1 lambda light antibody, SigmaMAb

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
23201100
NACRES:
NA.12

recombinant

expressed in CHO cells

Quality Level

200

shipped in

wet ice

storage temp.

−20°C

General description

SILU™ Lite SigmaMAb is a recombinant human monoclonal IgG1 lambda light antibody with a molecular mass of ∼150 kDa expressed in CHO cells. It is designed for optimization of accurate intact mass analysis of monoclonal antibodies, biosimilars, and pharmaceutical products. Accurate intact mass analysis of such large biomolecules can provide comprehensive information about structural and post-translational modifications such as glycosylation. Other information such as heterogeneity, batch-to-batch variation, amino acid truncation, and N-terminal Lys processing, aggregation, and degradation can be determined. Intact mass analysis using mass spectrometry is also very important for formulation and storage in therapeutic monoclonal antibody drug development.
It consists of two identical heavy chains and two identical light chains. The heavy chains and light chains are linked by one disulfide bond. The heavy chains are linked by two disulfide bonds located in a hinge domain. The other 12 cysteine bonds are intramolecularly restricted to six different globular domains. The antibody sequence has been evaluated by intact mass and peptide mapping using four different enzymes: chymotrypsin, Asp-N and Glu-C endoproteinases and trypsin. Sequence coverage of 100% was obtained.

Application

SILu™ Lite SigmaMAb Universal Antibody Standard human has been used as a model system to investigate the quantitative relationship between gas-phase monoclonal antibody (mAb) unfolding and the discrete levels of mAb glycosylation.

Features and Benefits

Calculated molecular weight values of the SigmaMAb light chains, heavy chains, and intact protein, with the most abundant glycoforms, are as follows:

Description / Composition / Modification / Average Mass (Da)

Light chain, reduced / C1006H1555N267O333S7 / Pyroglutamic acid (Q) / 22942.2

Heavy chain, reduced / C2181H3393N587O663S16 / (no modification) / 48957.8
C2237H3485N591O702S16 / G0F / 50403.2
C2243H3495N591O707S16 / G1F / 50565.3
C2249H3505N591O712S16 / G2F / 50727.5

Native intact mass, non-reduced / C6374H9864N1708O1992S46 / 2 X Pyroglutamic acid (Q) / 143767.7
C6486H10048N1716O2070S46 / G0F+G0F / 146658.4
C6492H10058N1716O2075S46 / G0F+G1F / 146820.6
C6498H10068N1716O2080S46 / G1F+G1F / 146982.7
C6504H10078N1716O2085S46 / G1F+G2F / 147144.8
C6510H10088N1716O2090S46 / G2F+G2F / 147307.0

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline

Preparation Note

SigmaMAb recovery is maximized when phosphate buffer, pH 6–7, is used to reconstitute the lyophilized product.

Analysis Note

SigmaMab Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SigmaMab Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS
Also available as a stable isotope-labled product, Silu™Mab (Product Number MSQC3)
Package size based on protein content determined by A280

Other Notes

Avoid PBS for reconstitution.
Reconstitute the contents of the vial by adding 500μL of ultrapure water or phosphate buffer, and mixing vigorously. The solubilized product can be further diluted as needed.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

11 - Combustible Solids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yutong Jin et al.
mAbs, 11(1), 106-115 (2018-09-20)
The pharmaceutical industry's interest in monoclonal antibodies (mAbs) and their derivatives has spurred rapid growth in the commercial and clinical pipeline of these effective therapeutics. The complex micro-heterogeneity of mAbs requires in-depth structural characterization for critical quality attribute assessment and
"Collision Induced Unfolding Detects Subtle Differences in Intact Antibody Glycoforms and Associated Fragments.
Tian Y and Brandon T R
International Journal of Mass Spectrometry (2017)
Daniel A Polasky et al.
Analytical chemistry, 91(4), 3147-3155 (2019-01-23)
Ion mobility-mass spectrometry (IM-MS) has become an important addition to the structural biology toolbox, but separating closely related protein conformations remain challenging. Collision-induced unfolding (CIU) has emerged as a valuable technique for distinguishing iso-cross-sectional protein and protein complex ions through
Jared B Shaw et al.
Analytical chemistry, 90(18), 10819-10827 (2018-08-18)
Compared to traditional collision induced dissociation methods, electron capture dissociation (ECD) provides more comprehensive characterization of large peptides and proteins as well as preserves labile post-translational modifications. However, ECD experiments are generally restricted to the high magnetic fields of FTICR-MS
Xi Qiu et al.
Bioanalysis, 10(13), 1055-1067 (2018-07-05)
Sample extraction using immuno-affinity capture coupled with LC-high-resolution mass spectrometer has recently emerged as a novel approach for the determination of concentrations of large molecules at intact level in biological matrix. In the current work, different data processing strategies for
View All Related Papers

Articles

Quantification of Host Cell Proteins

Residual presence of host cell proteins (HCPs) in recombinant therapeutic products has considerable clinical safety risks associated with a potential immunological response in patients.

Middle-Up Analysis of Antibodies by Reversed-Phase Chromatography

Comparative analysis of different columns in resolving medium-sized fragments of monoclonal antibodies, after digestion using dithiothreitol (DTT) or IdeS (a protease), by Reversed-Phase Chromatography.

A Rapid, Streamlined Workflow for Glycan Sample Preparation and Analysis by LC-MS

The use of PNGase Fast denaturing buffer and enzyme yielded results similar to a conventional 20-hour protocol with overnight digest while reducing workflow time to about 1 hour with a 15-minute digest.

Three Methods for Critical Quality Attribute Determination of Monoclonal Antibodies

Step-by-step workflows for the intact mass analysis, peptide mapping, and N-glycan analysis of the monoclonal antibody― adalimumab, for an accurate characterization of the critical quality attributes (CQAs) to ensure drug safety and efficacy. Read more.

Protocols

Antibody Drug Conjugate Mimic Enables LC-MS Method Development Without Risk

Here we show how LC and MS methods may be optimized using a non-toxic surrogate of the ADC, an “ADC-mimic”, that behaves very similarly to the Cys-linked ADC Adcetris (Seattle Genetics).

BIOshell™ IgG 1000 Å C4 UHPLC Column for Improved Biomacromolecule Separations

BIOshell™ IgG 1000 Å C4 UHPLC Column for Improved Biomacromolecule Separations

Protocol for Purification, Optional Reduction, and SEC-MS Analysis of a Monoclonal Antibody

A complete workflow for the intact and middle-up mass analysis of reduced and non-reduced monoclonal antibodies based on SEC-MS with sample preparation by protein-A affinity clean-up.

Related Content

Middle-up Mass Analysis of Protease Digested Cetuximab

Step-by-step reversed phase UHPLC-MS workflow for middle-up mass analysis of an immunoglobulin G antibody, consisting of antibody purification, IdeS proteolysis and reduction, mass spectrometer calibration, mAb quantification, and a system suitability test.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service