HPA037655
Anti-GUCY2C antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-GUC2C, Anti-Guanylate cyclase 2C (heat stable enterotoxin receptor), Anti-STAR
Sign Into View Organizational & Contract Pricing
All Photos(4)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:200-1:500
immunogen sequence
EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GUCY2C(2984)
General description
The guanylate cyclase 2C (GUCY2C) gene, mapped to human chromosome 12p12, codes for the transmembrane receptor guanylate cyclase C (GC-C). The encoded protein is expressed in intestine.
Immunogen
guanylate cyclase 2C (heat stable enterotoxin receptor) recombinant protein epitope signature tag (PrEST)
Application
GUCY2C antibody produced in rabbit has been used for western blot analysis.
Biochem/physiol Actions
Transmembrane receptor guanylate cyclase C (GC-C), encoded by guanylate cyclase 2C (GUCY2C), regulates the secretion of chloride. Alteration in the gene expression leads to congenital sodium diarrhoea (CSD). GUCY2C catalyzes the conversion of guanosine-5′-triphosphate (GTP) to cyclic guanosine monophosphate (cGMP), upon binding of its ligand guanylin and uroguanylin, which are paracrine hormones. GUCY2C functions as a tumor suppressor and hinders intestinal tumorigenesis by inhibiting the protein kinase B/AKT signaling pathway.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST79587
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Guanylin and uroguanylin stimulate lipolysis in human visceral adipocytes.
Rodriguez A
International Journal of Obesity, 40, 1405-1415 (2016)
Congenital secretory diarrhoea caused by activating germline mutations in GUCY2C.
Muller T
Gut, 65, 1306-1313 (2016)
A Rodríguez et al.
International journal of obesity (2005), 40(9), 1405-1415 (2016-04-26)
Uroguanylin and guanylin are secreted by intestinal epithelial cells as prohormones postprandially and act on the hypothalamus to induce satiety. The impact of obesity and obesity-associated type 2 diabetes (T2D) on proguanylin and prouroguanylin expression/secretion as well as the potential
Øystein Brenna et al.
Scandinavian journal of gastroenterology, 50(10), 1241-1252 (2015-05-17)
Activation of membrane receptor guanylate cyclase-C (GC-C) is implicated in gastrointestinal fluid and electrolyte balance, preservation of intestinal barrier integrity, anti-trophic effects and inhibition of pain sensation. To evaluate GC-C signaling, we examined the regulation of GC-C (GUCY2C/Gucy2c) and its
The hormone receptor GUCY2C suppresses intestinal tumor formation by inhibiting AKT signaling.
Lin JE
Gastroenterology, 138, 241-254 (2010)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service