Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

HPA005434

Sigma-Aldrich

Anti-STAB1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FEEL-1 antibody produced in rabbit, Anti-Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1 antibody produced in rabbit, Anti-MS-1 antigen antibody produced in rabbit, Anti-Stabilin-1 precursor antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

LEYKELKGDGPFTIFVPHADLMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGSIYLNDFARVVSSDHEAVNGILH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... STAB1(23166)

Related Categories

General description

Stabilin-1(STAB1) or common lymphatic endothelial and vascular endothelial receptor-1 (CLEVER-1) is a large, multidomain, type I transmembrane protein. It is expressed in cardiac and skeletal muscle; by macrophages in skin, gut, placenta, and pancreas; and in liver, spleen, bone marrow, and lymph nodes by sinusoidal endothelial cells. Also known as FEEL-1, it contains a proteoglycan-link protein-like sequence, 7 fasciclin domains, 2 RGD (Arg-Gly-Asp ) motifs, and 22 epidermal growth factor-like repeats.

Immunogen

Stabilin-1 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Stabilin-1(STAB1) or common lymphatic endothelial and vascular endothelial receptor-1 (CLEVER-1) helps in leukocyte adhesion and migration as well as regulation of angiogenesis. In human macrophages, it is responsible for trafficking between trans-Golgi network and early/sorting endosomes. In macrophages and endothelial cells, it mediates endocytosis by acting as an endocytic receptor. Stabilin-1 also acts as a receptor for acetylated low density lipoprotein (Ac-LDL), placental lactogen, SPARC protein, apoptotic bodies and bacteria, and thus is responsible for the scavenging action of macrophages. It is also responsible for the intracellular sorting of chitinase-like protein SI-CLP, which is endogenous in nature. Recent studies suggest that CLEVER-1 mediates metastasis of breast cancer and head and neck squamous cell carcinoma via the lymphatic system. Stabilin-1 is used as a marker for the diagnosis of cutaneous non-Langerhans cell histiocytoses.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70108

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Heikki Irjala et al.
Cancer research, 63(15), 4671-4676 (2003-08-09)
Although approximately 50% of cancers give rise to metastases via the lymphatic system, the mechanisms mediating this process have remained unknown. In this study, we have investigated the role of two lymphatic endothelial molecules, the mannose receptor (MR) and common
Julia Kzhyshkowska et al.
Blood, 107(8), 3221-3228 (2005-12-17)
Mammalian Glyco_18-domain-containing proteins include catalytically active chitinases and chitinase-like proteins with cytokine activity involved in host defense and Th2-type inflammatory reactions. Here, we describe a novel human Glyco_18-domain-containing protein, SI-CLP, as an interacting partner of the endocytic/sorting receptor stabilin-1. Similarly
Julia Kzhyshkowska et al.
Journal of leukocyte biology, 76(6), 1151-1161 (2004-09-04)
Stabilin-1 and stabilin-2 constitute a novel family of fasciclin domain-containing hyaluronan receptor homologues recently described by us. Whereas stabilin-1 is expressed in sinusoidal endothelial cells and in macrophages in vivo, stabilin-2 is absent from the latter. In the present study
Julia Kzhyshkowska
TheScientificWorldJournal, 10, 2039-2053 (2010-10-19)
The multifunctional scavenger receptor stabilin-1 (STAB1, FEEL-1, CLEVER-1, KIAA0246) is expressed on tissue macrophages and sinusoidal endothelial cells in healthy organisms, and its expression on both macrophages and different subtypes of endothelial cells is induced during chronic inflammation and tumor
Shishir Shetty et al.
Journal of immunology (Baltimore, Md. : 1950), 186(7), 4147-4155 (2011-03-04)
The common lymphatic endothelial and vascular endothelial receptor (CLEVER-1; also known as FEEL-1 and stabilin-1) is a recycling and intracellular trafficking receptor with multifunctional properties. In this study, we demonstrate increased endothelial expression of CLEVER-1/stabilin-1 at sites of leukocyte recruitment

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service