WH0377630M1
Monoclonal Anti-DUB3 antibody produced in mouse
clone 3G12, purified immunoglobulin, buffered aqueous solution
Synonim(y):
Anti-deubiquitinating enzyme 3
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
Polecane produkty
pochodzenie biologiczne
mouse
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
purified immunoglobulin
rodzaj przeciwciała
primary antibodies
klon
3G12, monoclonal
Postać
buffered aqueous solution
reaktywność gatunkowa
human
metody
indirect ELISA: suitable
western blot: 1-5 μg/mL
izotyp
IgG1κ
numer dostępu GenBank
Warunki transportu
dry ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... DUB3(377630)
Powiązane kategorie
Opis ogólny
DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information.[supplied by OMIM
Immunogen
DUB3 (NP_958804, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ
Sequence
ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ
Działania biochem./fizjol.
Deubiquitinating enzyme 3 (DUB3) has an important role in tumor growth. It associates with histone deacetylase HDAC2 and deubiquitinates it. DUB3 also modulates the ubiquitination of histone H2AX and thus contributes to the DNA damage response.
Postać fizyczna
Solution in phosphate buffered saline, pH 7.4
Informacje prawne
GenBank is a registered trademark of United States Department of Health and Human Services
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
nwg
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Bo Zhou et al.
Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 70, 84-89 (2015-03-18)
Dub3 is a deubiquitinating enzyme. It is highly expressed in tumor-derived cell lines and has an established role in tumor proliferation. However, the role of Dub3 in human ovarian cancer remains unclear. Expression of Dub3 was evaluated in ovarian cancer
Peter R Hull et al.
South African medical journal = Suid-Afrikaanse tydskrif vir geneeskunde, 103(12 Suppl 1), 961-965 (2013-12-05)
Keratolytic winter erythema (KWE), also known as Oudtshoorn skin disease, is characterised by a cyclical disruption of normal epidermal keratinisation affecting primarily the palmoplantar skin with peeling of the palms and soles, which is worse in the winter. It is
Lindsay B Henderson et al.
PLoS genetics, 8(3), e1002580-e1002580 (2012-03-23)
Meconium ileus (MI), a life-threatening intestinal obstruction due to meconium with abnormal protein content, occurs in approximately 15 percent of neonates with cystic fibrosis (CF). Analysis of twins with CF demonstrates that MI is a highly heritable trait, indicating that
Huihui Song et al.
International journal of clinical and experimental pathology, 8(9), 10707-10715 (2015-12-01)
Histone deacetylase HDAC2 regulates genes transcription via removing the acetyl group from histones. Glucocorticoids, the most potent anti-inflammatory treatment available for inflammatory diseases, inhibit the expression of inflammatory genes by recruiting HDAC2 to activated genes. In the lungs of patients
M Rocío Delgado-Díaz et al.
Molecular oncology, 8(5), 884-893 (2014-04-08)
A crucial event in the DNA damage response is the phosphorylation and subsequent ubiquitination of H2AX, required for the recruitment of proteins involved in DNA repair. Here we identify a novel regulator of this process, the ubiquitin hydrolase Dub3. Overexpression
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej