Przejdź do zawartości
Merck
Wszystkie zdjęcia(5)

Key Documents

WH0057492M1

Sigma-Aldrich

Monoclonal Anti-ARID1B antibody produced in mouse

clone 2D2, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-6A35, Anti-AT rich interactive domain 1B (SWI1-like), Anti-BAF250b, Anti-DAN15, Anti-ELD/OSA1, Anti-KIAA1235, Anti-p250R

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(5)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

2D2, monoclonal

Postać

buffered aqueous solution

reaktywność gatunkowa

human

metody

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

izotyp

IgG2bκ

numer dostępu GenBank

NM_017519

numer dostępu UniProt

Q8NFD5

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... ARID1B(57492)

Opis ogólny

AT-rich interaction domain 1B (ARID1B) is a member of SWItch/sucrose nonfermentable (SWI/SNF) chromatin remodelling complex. ARID1B gene is located on human chromosome 6q25.3.

Immunogen

ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR

Działania biochem./fizjol.

AT-rich interaction domain 1B (ARID1B) is involved in the regulation of transcription and multiple downstream cellular processes. ARID1B acts as a coactivator of cell cycle genes. ARID1B acts as tumor suppressor in pancreatic cancer cell line. Mutations in ARID1B might be associated with Coffin-Siris syndrome (CSS).

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

nwg

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Corpus callosum abnormalities, intellectual disability, speech impairment, and autism in patients with haploinsufficiency of ARID1B
Halgren, et al.
Clinical Genetics, 82(3), 248-255 (2012)
Dynamics of expression of ARID1A and ARID1B subunits in mouse embryos and in cells during the cell cycle
Flores-A, et al.
Cell and Tissue Research, 345(1), 137-148 (2011)
ARID1B, a member of the human SWI/SNF chromatin remodeling complex, exhibits tumour-suppressor activities in pancreatic cancer cell lines
Khurshee et al.
British Journal of Cancer, 108(10), 2056-2056 (2013)
Mutations in SWI/SNF chromatin remodeling complex gene ARID1B cause Coffin-Siris syndrome
Santen G,et al.
Nature Genetics, 44(4), 379-379 (2012)
L Backx et al.
Cytogenetic and genome research, 132(3), 135-143 (2010-11-03)
We identified a male patient presenting with intellectual disability and agenesis of the corpus callosum, carrying an apparently balanced, reciprocal, de novo translocation t(6;14)(q25.3;q13.2). Breakpoint mapping, using array painting, identified 2 interesting candidate genes, ARID1B and MRPP3, disrupted in the
Wyświetl wszystkie powiązane dokumenty

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej