WH0057348M4
Monoclonal Anti-TTYH1 antibody produced in mouse
clone 4A9, purified immunoglobulin, buffered aqueous solution
Synonim(y):
Anti-tweety homolog 1 (Drosophila)
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
białko sprzężone:
unconjugated
application:
ELISA (i)
WB
WB
klon:
4A9, monoclonal
reaktywność gatunkowa:
human
citations:
5
metody:
indirect ELISA: suitable
western blot: 1-5 μg/mL
western blot: 1-5 μg/mL
Polecane produkty
pochodzenie biologiczne
mouse
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
purified immunoglobulin
rodzaj przeciwciała
primary antibodies
klon
4A9, monoclonal
Formularz
buffered aqueous solution
reaktywność gatunkowa
human
metody
indirect ELISA: suitable
western blot: 1-5 μg/mL
izotyp
IgG2aκ
numer dostępu GenBank
numer dostępu UniProt
Warunki transportu
dry ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... TTYH1(57348)
Powiązane kategorie
Opis ogólny
This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)
Immunogen
TTYH1 (NP_065710, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYYLLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN
Sequence
MGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYYLLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN
Działania biochem./fizjol.
The gene TTYH1 (tweety homolog 1) encodes a protein that functions as a chloride channel. It may be involved in early embryonic development. It is suggested to function in cell process formation and cell adhesion. Its expression in brain is found to be increased during epileptogenesis and epilepsy, indicating its involvement in brain pathology.
Postać fizyczna
Solution in phosphate buffered saline, pH 7.4
Informacje prawne
GenBank is a registered trademark of United States Department of Health and Human Services
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
nwg
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Marzena Stefaniuk et al.
Journal of neurochemistry, 115(5), 1183-1194 (2010-09-30)
We have previously shown that Ttyh1 mRNA is expressed in neurons and its expression is up-regulated in the brain during epileptogenesis and epilepsy. In this study, we aimed to elucidate the role of Ttyh1 in neurons. We found widespread expression
Elzbieta Wiernasz et al.
Neurochemical research, 39(12), 2516-2526 (2014-10-16)
In a previous study, we showed that Ttyh1 protein is expressed in neurons in vitro and in vivo in the form of punctuate structures, which are localized to neuropil and neuronal somata. Herein, we provide the first description of Ttyh1
Expression of Ttyh1, a member of the Tweety family in neurons in vitro and in vivo and its potential role in brain pathology.
Stefaniuk M
Journal of Neurochemistry, 115, 1183-1194 (2010)
Malgorzata Gorniak-Walas et al.
Neurochemical research, 46(9), 2463-2472 (2021-06-27)
Tweety-homolog 1 protein (Ttyh1) is abundantly expressed in neurons in the healthy brain, and its expression is induced under pathological conditions. In hippocampal neurons in vitro, Ttyh1 was implicated in the regulation of primary neuron morphology. However, the mechanisms that
Long-term survival in a case of ETANTR with histological features of neuronal maturation after therapy.
Antonelli M
Virchows Archiv, 466, 603-607 (2015)
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej