Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Kluczowe dokumenty

WH0006279M1

Sigma-Aldrich

Monoclonal Anti-S100A8 antibody produced in mouse

clone 2H2, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-60B8AG, Anti-CAGA, Anti-CFAG, Anti-CGLA, Anti-CP10, Anti-L1Ag, Anti-MA387, Anti-MIF, Anti-MRP8, Anti-NIF, Anti-P8, Anti-S100 calcium binding protein A8 (calgranulin A)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.43
białko sprzężone:
unconjugated
application:
ELISA (i)
WB
klon:
2H2, monoclonal
reaktywność gatunkowa:
human
citations:
3
metody:
indirect ELISA: suitable
western blot: 1-5 μg/mL

pochodzenie biologiczne

mouse

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

2H2, monoclonal

Formularz

buffered aqueous solution

reaktywność gatunkowa

human

metody

indirect ELISA: suitable
western blot: 1-5 μg/mL

izotyp

IgG2aκ

numer dostępu GenBank

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... S100A8(6279)

Opis ogólny

The gene S100A8 (S100 calcium-binding protein A8) is mapped to human chromosome 1q21. It is also known as myeloid-related protein 8 (MRP8) or calgranulin A. It is a small calcium-binding protein, which is strongly expressed in neutrophils. In presence of cell stimulation, it is also expressed in monocytes, macrophages, platelets and epithelial and endothelial cells. S100A8 protein is present as a homodimer as well as heterodimer. The protein has two EF-hand motifs and one high-affinity Ca2+ binding site.

Immunogen

S100A8 (AAH05928.1, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Działania biochem./fizjol.

S100A8 (S100 calcium-binding protein A8) is mainly present at the inflammation site or in the serum during acute and chronic inflammation. It is responsible for neutrophil recruitment, attachment and release from the bone marrow. S100A8 is crucial for sending neutrophils to the site of inflammation in the presence of bacterial infection, lipopolysaccharide and monosodium urate crystals. The protein is also involved in granulocyte and monocyte attachment to endothelium and also their transport across endothelial cells. The S100A8/A9 heterodimer induces monocyte migration and cytokine secretion. In the presence of falciparum malaria, high levels of S100A8 are present in the blood.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Secretion of S100A8, S100A9, and S100A12 by Neutrophils Involves Reactive Oxygen Species and Potassium Efflux.
Tardif MR
Journal of immunology research (2015)
Additive effect of the AZGP1, PIP, S100A8 and UBE2C molecular biomarkers improves outcome prediction in breast carcinoma.
Parris TZ
International Journal of Cancer. Journal International Du Cancer (2014)
mRNA Expression of S100A8 as a Prognostic Marker for Progression of Non-Muscle-Invasive Bladder Cancer.
Ha YS
Korean Journal of Urology (2010)
Comparative proteomic analysis reveals activation of mucosal innate immune signaling pathways during cholera.
Ellis CN
Infection and Immunity (2015)
Up-regulated S100 calcium binding protein A8 in Plasmodium-infected patients correlates with CD4(+)CD25(+)Foxp3 regulatory T cell generation.
Malaria Journal (2015)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej