Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Kluczowe dokumenty

WH0004904M1

Sigma-Aldrich

Monoclonal Anti-YBX1 antibody produced in mouse

clone 4F12, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-BP8, Anti-CSDB, Anti-DBPB, Anti-MDRNF1, Anti-MGC104858, Anti-MGC110976, Anti-NSEP1, Anti-YB1, Anti-YBX1, Anti-nuclease sensitive element binding protein 1

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(3)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

4F12, monoclonal

Formularz

buffered aqueous solution

reaktywność gatunkowa

human

metody

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

izotyp

IgG2aκ

numer dostępu GenBank

NM_004559

numer dostępu UniProt

P67809

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... YBX1(4904)

Powiązane kategorie

Opis ogólny

Y-box binding protein 1 (YBX1) gene codes for Y-box protein 1 (YB-1) that has 324 amino acid residues, 8 exons and 7 introns. It is a member of the family of multifunctional DNA/RNA binding proteins. It is mainly present in the cytosol. YBX1 gene is mapped to human chromosome 1p34.

Immunogen

YBX1 (NP_004550, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA

Działania biochem./fizjol.

Y-box binding protein 1 (YBX1) participates in pre-mRNA splicing, transcriptional regulation and mRNA translation and stability. It is also involved in DNA repair and environmental stress responses and chromatin remodeling.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number
09125-4F12
08088-4F12

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Wyszukaj dokument COA

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

YBX1 (Y box binding protein 1)
Evdokimova V and Sorokin A
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2011)
Andreas Zaucker et al.
Nucleic acids research, 46(1), 104-119 (2017-10-24)
In many organisms, transcriptional and post-transcriptional regulation of components of pathways or processes has been reported. However, to date, there are few reports of translational co-regulation of multiple components of a developmental signaling pathway. Here, we show that an RNA
Jiawei Sun et al.
Development (Cambridge, England), 145(19) (2018-08-24)
Maternal mRNAs and proteins dictate early embryonic development before zygotic genome activation. In the absence of transcription, elaborate control of maternal mRNA translation is of particular importance for oocyte maturation and early embryogenesis. By analyzing zebrafish ybx1 mutants with a

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej