WH0003925M1

Monoclonal Anti-STMN1 antibody produced in mouse

clone 3A9, ascites fluid

• Synonim(y): Anti-LAP18, Anti-Lag, Anti-OP18, Anti-PP17, Anti-PP19, Anti-PR22, Anti-SMN, Anti-stathmin 1/oncoprotein 18
• Kod UNSPSC: 12352203

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: ascites fluid
• rodzaj przeciwciała: primary antibodies
• klon: 3A9, monoclonal
• reaktywność gatunkowa: human
• metody: immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1:500-1:1000
• izotyp: IgMκ
• numer dostępu GenBank: BC014353
• numer dostępu UniProt: P16949
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... STMN1(3925)

Opis

Opis ogólny

This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

STMN1 (AAH14353, 40 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Postać fizyczna

Solution

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)