Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Kluczowe dokumenty

WH0003043M1

Sigma-Aldrich

Monoclonal Anti-HBB antibody produced in mouse

clone 2H3, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-CD113tC, Anti-HBD, Anti-hemoglobin, Anti-hemoglobin, beta

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Numer MDL:
Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

2H3, monoclonal

Formularz

buffered aqueous solution

reaktywność gatunkowa

human

metody

ELISA: suitable
capture ELISA: suitable
western blot: 1-5 μg/mL

izotyp

IgG3κ

numer dostępu GenBank

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... HBB(3043)

Opis ogólny

HBB (hemoglobin subunit β) codes for a β-globin that consists of three exons. This gene is located on human chromosome 11p15. HBB is a serum protein that belongs to the histone-like protein family.
The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5′-epsilon -- gamma-G -- gamma-A -- delta -- beta--3′. (provided by RefSeq)

Immunogen

HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH

Działania biochem./fizjol.

HBB (hemoglobin subunit β) participates in oxygen transport from the lung to various peripheral tissues. Mutation in HBB result in Sickle cell disease (SCD). Overexpression of HBB has been observed in patients with periodontal disease.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

A phylogenetic analysis of Borrelia burgdorferi sensu lato based on sequence information from the hbb gene, coding for a histone-like protein
Valsangiacomo C, et al.
International Journal of Systematic Bacteriology, 47(1), 1-10 (1997)
Wei Li et al.
Haematologica, 93(3), 356-362 (2008-02-13)
beta-thalassemia is one of the most common genetic diseases in the world and requires extensive therapy. Lentiviral-mediated gene therapy has been successfully exploited in the treatment of beta-thalassemia and showed promise in clinical application. Using a human beta-globin transgenic mouse
Proteomic analysis of saliva identifies potential biomarkers for orthodontic tooth movement
Ellias MF, et al.
TheScientificWorldJournal (2012)
Shu-Yang Xie et al.
Human molecular genetics, 16(21), 2616-2625 (2007-08-25)
The beta-thalassemia is associated with abnormality in beta-globin gene, leading to imbalanced synthesis of alpha-/beta-globin chains. Consequently, the excessive free alpha-globin chains precipitate to the erythrocyte membrane, resulting in hemolytic anemia. We have explored post-transcriptional strategies aiming at alpha-globin reduction
Loss of heterozygosity for chromosome 11 in primary human breast tumors is associated with poor survival after metastasis
Winqvist R, et al.
Cancer Research, 55(12), 2660-2664 (1995)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej