WH0000516M1

Monoclonal Anti-ATP5G1 antibody produced in mouse

clone 1A12, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9), Anti-ATP5A, Anti-ATP5G
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 1A12, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: BC004963
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ATP5G1(516)

Opis

Opis ogólny

ATP synthase membrane subunit c locus 1 (ATP5G1) is encoded by the gene mapped to human chromosome 17q21.32. The encoded protein belongs to the low transcript gene group.

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (α, β, γ, δ, and ε) assembled with a stoichiometry of 3 α, 3 β, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. (provided by RefSeq)

Immunogen

ATP5G1 (AAH04963, 18 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Działania biochem./fizjol.

ATP synthase membrane subunit c locus 1 (ATP5G1) is one among the three genes that encodes mitochondrial ATP synthase subunit c of the proton channel. Regulation of this protein is implicated in the biogenesis of mammalian H⁺ -ATP synthase. Mutation in the gene is associated with the development of coronary artery disease (CAD).

Cechy i korzyści

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)