SAB5702648

Anti-Annexin A5/Annexin V Antibody, clone 9A5M8, Rabbit Monoclonal

• Synonim(y): ANX5, ENX2, HEL-S-7, PP4, RPRGL3
• Kod UNSPSC: 12352203
• NACRES: NA.46

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 9A5M8, monoclonal
• Postać: liquid
• masa cząsteczkowa: 36 kDa
• reaktywność gatunkowa: human, rat, rat
• stężenie: 0.5 mg/mL
• metody: western blot: 1:500 - 1:2000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: IEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
• numer dostępu UniProt: P08758
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ANXA5(308)

Opis

Opis ogólny

The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 221-320 of human Annexin A5/Annexin A5/Annexin V (P08758).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1