Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

SAB2107086

Sigma-Aldrich

Anti-SNX10 antibody produced in rabbit

affinity isolated antibody

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

22 kDa

reaktywność gatunkowa

rat, human, mouse, bovine, pig, horse, rabbit

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NM_001127348

numer dostępu UniProt

Q9CWT3

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SNX10(29887)
mouse ... Snx10(71982)

Opis ogólny

Sorting nexin 10 (SNX10) is a transmembrane protein belonging to SNX family. SNX10 has phox domain which binds to phosphoinositide-binding domain. In human chromosome, the gene SNX10 is located on 7p15.2.

Immunogen

The immunogen for anti-SNX10 antibody: synthetic peptide derected towards the middle region of human SNX10

Działania biochem./fizjol.

Snx10 may be involved in several stages of intracellular trafficking. May play a role in endosome homeostasis. Overexpression causes formation of huge vacuoles. Mutations in SNX10 leads to autosomal recessive osteoporosis due to dysregulation of osteoclasts. SNX10 interaction with vacuolar-type H+ -ATPase (V-ATPase) complex initiates ciliogenesis, critical for early embryonic development.

Sekwencja

Synthetic peptide located within the following region: DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

12 - Non Combustible Liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

SNX10 gene mutation leading to osteopetrosis with dysfunctional osteoclasts
Stattin EL, et al.
Scientific Reports, 7(1), 3012-3012 (2017)
A novel mutation in SNX10 gene causes malignant infantile Osteopetrosis
Amirfiroozy A, et al.
Avicenna Journal of Medical Biotechnology, 9(4), 205-205 (2017)
Ting Hu et al.
Folia neuropathologica, 59(4), 359-371 (2022-02-05)
Gliomas are the most seen tumours in adults in the central nervous system, and high grade of gliomas cause the worse prognose of patients with a shorter survival period. Ubiquitin-specific protease 38 (USP38) has been regarded as the negative regulator
Baoming Qin et al.
The Journal of biological chemistry, 281(48), 36891-36896 (2006-10-03)
Eukaryotic cells maintain a sophisticated network of intracellular membranous system to ensure the proper distribution and compartmentalization of cellular proteins critical for diverse functions such as cell division or cell-cell communication. Yet, little is known about the mechanism that regulates
Yanqun Chen et al.
Cell research, 22(2), 333-345 (2011-08-17)
Sorting nexins (SNXs) are phosphoinositide-binding proteins implicated in the sorting of various membrane proteins in vitro, but the in vivo functions of them remain largely unknown. We reported previously that SNX10 is a unique member of the SNX family genes

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej