SAB2102202

Anti-SLC33A1 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-ACATN, Anti-AT1, Anti-Solute carrier family 33 (acetyl-CoA transporter), member 1
• Numer MDL: MFCD01321727
• Kod UNSPSC: 12352203
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 61 kDa
• reaktywność gatunkowa: rat, human, mouse, horse, rabbit
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu UniProt: O00400
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SLC33A1(9197)

Opis

Immunogen

Synthetic peptide directed towards the middle region of human SLC33A1

Działania biochem./fizjol.

SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Sekwencja

Synthetic peptide located within the following region: CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable