Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

SAB2102181

Sigma-Aldrich

Anti-SLC24A6 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-FLJ22233, Anti-NCKX6, Anti-NCLX, Anti-Solute carrier family 24, member 6

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

64 kDa

reaktywność gatunkowa

human, rabbit, rat, guinea pig, bovine, mouse, dog, horse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu UniProt

Q6J4K2

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SLC24A6(80024)

Opis ogólny

Solute carrier family 24, member 6 (SLC24A6) or solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 (SLC8B1) gene codes for Na+/Ca2+/Li+ exchanger (NCLX). NCLX belongs to the Na+/Ca2+ exchanger (NCX) family. This protein is expressed at a high level in the brain, skeletal and heart muscle, pancreas β-cells, and lymphocyte B-cells. NCLX contains a small regulatory domain that has a phosphorylation site and lacks Ca2+ binding domains (CBDs).

Immunogen

Synthetic peptide directed towards the middle region of human SLC24A6

Zastosowanie

Anti-SLC24A6 antibody produced in rabbit has been used in western blotting(1:250).

Działania biochem./fizjol.

Solute carrier family 8, member B1 (SLC8B1)/Na+/Ca2+/Li+ exchanger (NCLX) helps in the transportation of the sodium or lithium-ion in exchange for the calcium ion.

Sekwencja

Synthetic peptide located within the following region: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Marko Kostic et al.
Seminars in cell & developmental biology, 94, 59-65 (2019-01-19)
Mitochondrial Ca2+ transient is the earliest discovered organellar Ca2+ signaling pathway. It consist of a Ca2+ influx, mediated by mitochondrial Ca2+ uniporter (MCU), and mitochondrial Ca2+ efflux mediated by a Na+/Ca2+ exchanger (NCLX). Mitochondrial Ca2+ signaling machinery plays a fundamental
Marko Kostic et al.
Cell reports, 25(12), 3465-3475 (2018-12-20)
Calcium is a key regulator of mitochondrial function under both normal and pathological conditions. The mechanisms linking metabolic activity to mitochondrial Ca2+ signaling remain elusive, however. Here, by monitoring mitochondrial Ca2+ transients while manipulating mitochondrial membrane potential (ΔΨm), we found
Olha M Koval et al.
Science signaling, 12(579) (2019-05-02)
The role of the mitochondrial Ca2+ uniporter (MCU) in physiologic cell proliferation remains to be defined. Here, we demonstrated that the MCU was required to match mitochondrial function to metabolic demands during the cell cycle. During the G1-S transition (the

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej