SAB2101653

Anti-NRF1 (ab1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-α-PAL, Anti-Nuclear respiratory factor 1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 53 kDa
• reaktywność gatunkowa: rat, mouse, bovine, human, horse, rabbit, guinea pig, dog
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu UniProt: Q16656
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NRF1(4899)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human NRF1

Działania biochem./fizjol.

NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for ′nuclear factor (erythroid-derived 2)-like 1′ which has an official symbol of NFE2L1.

Sekwencja

Synthetic peptide located within the following region: MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable