Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Key Documents

SAB2100143

Sigma-Aldrich

Anti-ARF1 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-ADP-ribosylation factor 1

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(3)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

21 kDa

reaktywność gatunkowa

mouse, human, guinea pig, rat, yeast, sheep, dog, rabbit, horse, bovine

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
immunoprecipitation (IP): suitable
western blot: suitable

numer dostępu UniProt

P61204

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... ARF1(375)

Opis ogólny

Adenosine diphosphate ribosylation factor 1 (ARF1) protein belongs to the class I ARF family of proteins. This protein is present in the Golgi apparatus. The ARF1 gene is located on the human chromosome at 1q42.13.

Immunogen

Synthetic peptide directed towards the middle region of human ARF1

Zastosowanie

Anti-ARF1 antibody produced in rabbit has been used in western blotting.

Działania biochem./fizjol.

Adenosine diphosphate ribosylation factor 1 (ARF1) plays a role in mediating retrograde and anterograde vesicular traffic. This protein also plays a role in the synthesis of coat protein I (COP-I) coated vesicles. ARF1 is involved in the recruitment of clathrin adaptor complexes such as activator protein 1, 3, and 4. The activation of ARF1 triggers the assembly of spectrin as well as actin cytoskeleton in the Golgi membranes.

Sekwencja

Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Transcriptional features of multiple myeloma patients with chromosome 1q gain.
S Fabris et al.
Leukemia, 21(5), 1113-1116 (2007-02-23)
Yoshimi Ohashi et al.
The Journal of biological chemistry, 287(6), 3885-3897 (2011-12-14)
ADP-ribosylation factor 1 (Arf1) plays a major role in mediating vesicular transport. Brefeldin A (BFA), a known inhibitor of the Arf1-guanine nucleotide exchange factor (GEF) interaction, is highly cytotoxic. Therefore, interaction of Arf1 with ArfGEF is an attractive target for
Zhe Sun et al.
Traffic (Copenhagen, Denmark), 8(5), 582-593 (2007-04-25)
The small GTPase ADP-ribosylation factor-1 (Arf1) plays a key role in the formation of coat protein I (COP I)-coated vesicles. Upon recruitment to the donor Golgi membrane by interaction with dimeric p24 proteins, Arf1's GDP is exchanged for GTP. Arf1-GTP
Crislyn D'Souza-Schorey et al.
Nature reviews. Molecular cell biology, 7(5), 347-358 (2006-04-25)
The ADP-ribosylation factor (ARF) small GTPases regulate vesicular traffic and organelle structure by recruiting coat proteins, regulating phospholipid metabolism and modulating the structure of actin at membrane surfaces. Recent advances in our understanding of the signalling pathways that are regulated
Ok-Ryul Song et al.
EMBO reports, 19(1), 29-42 (2017-11-17)
The interaction of Mycobacterium tuberculosis (Mtb) with pulmonary epithelial cells is critical for early stages of bacillus colonization and during the progression of tuberculosis. Entry of Mtb into epithelial cells has been shown to depend on F-actin polymerization, though the

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej