AV53631
Anti-NUP98 antibody produced in rabbit
affinity isolated antibody
Synonim(y):
Anti-ADIR2, Anti-NUP196, Anti-Nucleoporin 98 kDa
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Postać
buffered aqueous solution
masa cząsteczkowa
98 kDa
reaktywność gatunkowa
horse, human, rabbit, bovine, rat
stężenie
0.5 mg - 1 mg/mL
metody
western blot: suitable
numer dostępu NCBI
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... NUP98(4928)
Opis ogólny
Nuclear pore complex protein is a protein encoded by the nucleoporin 98 kDa (NUP98) gene in humans. NUP98 gene encodes a peripheral membrane protein nucleoporin that belongs to nucleoporin GLFG family. This protein is formed from a precursor protein of 186 kDa that after cleavage yields two nucleoporins, Nup96 and Nup98. The nuclear import and export takes place through the nuclear pore complex (NPC), which is composed of unique proteins known as nucleoporins. The NUP98 gene of 122kb long, has 33 exons and is located on human chromosome 11p15.4.
Immunogen
Synthetic peptide directed towards the N terminal region of human NUP98
Zastosowanie
Anti-NUP98 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Działania biochem./fizjol.
Nucleoporin 98 kDa (NUP98) functions as a docking protein for cytosol mediated docking of import substrates. During mitosis, NUP98 interacts with nucleocytoplasmic transport factors Rae1 and regulates the destruction of the securin protein by the anaphase-promoting complex (APC). Thus, Nucleoporins play an important function in nucleocytoplasmic transport, transcription and mitosis. Nuclear pore complex (NPC) also plays a role during nuclear processes such as chromatin silencing, transcriptional regulation and DNA damage repair. NUP98-Rae1 complex prevents aneuploidy. Overexpression of NUP98 along with other proteins and several associated nuclear export factors dysregulate signaling pathways and transcription resulting in alteration of nucleoporin functionality, which may cause cancer. NUP98 acts as an important predictor of anthracycline-based chemotherapy response in triple-negative breast cancer patients.
Sekwencja
Synthetic peptide located within the following region: EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF
Postać fizyczna
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Dan N Simon et al.
Advances in experimental medicine and biology, 773, 285-307 (2014-02-25)
The nuclear pore complex (NPC) mediates trafficking between the cytoplasm and nucleoplasm. It also plays key roles in other nuclear processes such as chromatin silencing, transcriptional regulation, and DNA damage repair. Nucleoporins, the structural components of the NPC, have been
Paul B Mullan et al.
BMC cancer, 19(1), 236-236 (2019-04-03)
Triple Negative breast cancer (TNBC) is a poor outcome subgroup of breast cancer defined based on the absence of expression of ERα and PR and HER2 amplification. These hard to treat cancers lack targeted treatment options and are therefore treated
S P Romana et al.
Leukemia, 20(4), 696-706 (2006-02-10)
The NUP98 gene is fused with 19 different partner genes in various human hematopoietic malignancies. In order to gain additional clinico-hematological data and to identify new partners of NUP98, the Groupe Francophone de Cytogénétique Hématologique (GFCH) collected cases of hematological
Akiko Takeda et al.
Seminars in cancer biology, 27, 3-10 (2014-03-25)
Hematologic malignancies are often associated with chromosomal rearrangements that lead to the expression of chimeric fusion proteins. Rearrangements of the genes encoding two nucleoporins, NUP98 and NUP214, have been implicated in the pathogenesis of several types of hematologic malignancies, particularly
Y Arai et al.
Blood, 89(11), 3936-3944 (1997-06-01)
The inv(11)(p15q22) is a recurrent chromosomal abnormality associated with de novo and therapy-related myeloid malignancies. Here we report the molecular definition of this chromosomal aberration in four patients. Positional cloning showed the consistent rearrangement of the DDX10 gene on chromosome
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej