SAB1412416

ANTI-MEOX1 antibody produced in mouse

clone 4E10, purified immunoglobulin, buffered aqueous solution

• Synonim(y): MEOX1, MOX1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 4E10, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen 35.41999 kDa
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2aκ
• numer dostępu NCBI: NM_004527
• numer dostępu UniProt: P50221
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... MEOX1(4222)

Opis

Opis ogólny

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. (provided by RefSeq)

Immunogen

MEOX1 (NP_004518, 82 a.a. ~ 170 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSK*

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable