Przejdź do zawartości
Merck
Wszystkie zdjęcia(4)

Kluczowe dokumenty

SAB1403712

Sigma-Aldrich

Monoclonal Anti-CTLA4 antibody produced in mouse

clone 2F1, purified immunoglobulin, buffered aqueous solution

Synonim(y):

CD152, CELIAC3, CTLA-4, GSE, IDDM12

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

2F1, monoclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

antigen ~37.11 kDa

reaktywność gatunkowa

human

metody

capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

izotyp

IgG2aκ

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... CTLA4(1493)

Opis ogólny

The CTLA4 (cytotoxic T lymphocyte associated-4) gene is mapped to human chromosome 2q33. It is a glycoprotein found on T-cells and is homologous to CD28 (Cluster of Differentiation 28) at the juxtamembrane and cytoplasmic regions.

Immunogen

CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY

Działania biochem./fizjol.

The CTLA4 (cytotoxic T lymphocyte associated-4) gene encodes a membrane receptor on cytotoxic T-cells that functions in T-cell apoptosis. It is a strong inhibitor of T-cell activation. It may be associated with type 1 diabetes. The gene has been identified as a susceptibility locus for Graves′ disease. It may be involved in the pathogenesis of autoimmune disorders.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

The CTLA-4 gene region of chromosome 2q33 is linked to, and associated with, type 1 diabetes.
Nistico L, et al.
Human Molecular Genetics, 5(7), 1075-1080 (1996)
CTLA-4 is a second receptor for the B cell activation antigen B7.
Linsley P S, et al.
The Journal of Experimental Medicine, 174(3), 561-569 (1991)
The development of Graves? disease and the CTLA-4 gene on chromosome 2q33.
Heward J M, et al.
The Journal of Clinical Endocrinology and Metabolism, 84(7), 2398-2401 (1999)
Daniele Saverino et al.
PloS one, 9(11), e112509-e112509 (2014-11-11)
Primary biliary cirrhosis (PBC) is a chronic autoimmune cholestatic liver disease frequently characterized by anti-mitochondrial autoantibodies (AMA). A minority of patients are AMA-negative. Cytotoxic-T-Lymphocyte-Antigen-4 (CTLA-4) is a surface molecule expressed on activated T-cells delivering a critical negative immunoregulatory signal. A
Sigrid Regauer et al.
Histology and histopathology, 29(8), 1017-1025 (2014-01-10)
Introduction. Lichen planus (LP) is a chronic cytokine-mediated disease of possible auto-immune etiology. 25% of men have anogenital manifestations. Erosive penile LP causes a scarring phimosis of the foreskin in uncircumcised men. Mast cells as potent immune modulators have been

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej