SAB1402920

Monoclonal Anti-SLC5A3 antibody produced in mouse

clone 3A6, purified immunoglobulin, buffered aqueous solution

• Synonim(y): SMIT, SMIT2
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3A6, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~38.1 kDa
• reaktywność gatunkowa: human
• metody: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu NCBI: NM_006933
• numer dostępu UniProt: P53794
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SLC5A3(6526)

Opis

Opis ogólny

Solute carrier family 5 member 3 (SLC5A3) is a member of SLC5A gene family, which shares five transmembrane segment inverted repeats of the LeuT structural family. SLC5A3 is expressed in brain, kidney and placenta. SLC5A3 gene is located on human chromosome 21q22.11.

Immunogen

SLC5A3 (NP_008864, 533 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE

Zastosowanie

Monoclonal Anti-SLC5A3 antibody produced in mouse has been used in dSTORM (direct stochastic optical reconstruction microscopy).

Działania biochem./fizjol.

Solute carrier family 5 member 3 (SLC5A3) functions in cellular osmoregulation. Overexpression of SLC5A3 contributes to pathophysiology of Down syndrome. SLC5A3 acts as a transporter in hypotonic volume regulation of mammalian cells. SLC5A3 regulates millimolar intracellular concentrations of myo-inositol and promotes transepithelial myo-inositol transport in kidney, intestine, retina and choroid plexus.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable