Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Kluczowe dokumenty

SAB1401583

Sigma-Aldrich

Monoclonal Anti-STAB1 antibody produced in mouse

clone 4G9, purified immunoglobulin, buffered aqueous solution

Synonim(y):

CLEVER-1, FEEL-1, FELE-1, FEX1, KIAA0246, STAB-1

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

4G9, monoclonal

Formularz

buffered aqueous solution

reaktywność gatunkowa

human

metody

capture ELISA: suitable
immunofluorescence: suitable
western blot: 1-5 μg/mL

izotyp

IgG2aκ

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... STAB1(23166)

Opis ogólny

Stabilin 1 (STAB1) gene encodes a large, transmembrane receptor protein which may function in angiogenesis, lymphocyte homing, cell adhesion, or receptor scavenging. The protein contains 7 fasciclin, 16 epidermal growth factor (EGF)-like, and 2 laminin-type EGF-like domains as well as a C-type lectin-like hyaluronan-binding Link module. The protein is primarily expressed on sinusoidal endothelial cells of liver, spleen, and lymph node. The receptor has been shown to endocytose ligands such as low density lipoprotein, Gram-positive and Gram-negative bacteria, and advanced glycosylation end products. Supporting its possible role as a scavenger receptor, the protein rapidly cycles between the plasma membrane and early endosomes. (provided by RefSeq).
Stabilin 1 (STAB1) is expressed on tissue macrophages and sinusoidal endothelial cells. It is a type-1 transmembrane receptor. STAB1 is expressed in alternatively activated macrophages. STAB1 gene is located on human chromosome 3p21.1.

Immunogen

STAB1 (NP_055951, 1804 a.a. ~ 1902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ

Działania biochem./fizjol.

Stabilin 1 (STAB1) maintains tissue homeostasis and prevents autoimmunity. STAB1 mediates endocytic and phagocytic clearance of undesirable internal components. STAB1 is an immunosuppressive molecule and reduces proinflammatory reactions in vivo.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Monocyte Stabilin-1 suppresses the activation of TH1 lymphocytes
Palani S, et al.
Journal of Immunology, 1500257-1500257 (2015)
Stabilin-1, a homeostatic scavenger receptor with multiple functions
Kzhyshkowska J, et al.
Journal of Cellular and Molecular Medicine, 10(3) (2006)
Stabilin-1 mediates phosphatidylserine-dependent clearance of cell corpses in alternatively activated macrophages
Park S, et al.
Journal of Cell Science, 122(18) (2009)
Multifunctional receptor stabilin-1 in homeostasis and disease
Kzhyshkowska J, et al.
TheScientificWorldJournal, 10(1) (2010)
Allelic expression analysis of the osteoarthritis susceptibility locus that maps to chromosome 3p21 reveals cis-acting eQTLs at GNL3 and SPCS1
Gee F, et al.
BMC Medical Genetics, 15(1), 53-53 (2014)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej