HPA030867

Anti-ADAM12 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-ADAM metallopeptidase domain 12, Anti-ERBB, Anti-ERBB1, Anti-MCMPMltna, Anti-MLTN
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA030867
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• rozszerzona walidacja: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• metody: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• sekwencja immunogenna: LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN
• numer dostępu UniProt: O43184
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ADAM12(8038)

Opis

Opis ogólny

ADAM12 (metallopeptidase domain 12) gene is mapped in human chromosome 10q26.2. ADAM12 is highly expressed in placenta. The gene encodes for two variant proteins, a full-length membrane-bound isoform (ADAM12L) and a truncated secreted variant (ADAM12S).

Immunogen

ADAM metallopeptidase domain 12 recombinant protein epitope signature tag (PrEST)

Zastosowanie

ADAM12 has been used to create antibody suspension bead array to study affinity-based profiling of serum and plasma by microarray assays.

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Działania biochem./fizjol.

ADAM12 (metallopeptidase domain 12) is a metalloprotease disintegrin and catalyzes cell context-dependent cleavage of transmembrane receptors, growth factor precursors, or adhesion molecules. Abnormal expression of the gene is mostly observed in many human cancers including breast, colon, hepatocellular carcinomas, glioblastomas, stomach, oral cavity, bladder, lung and giant cell tumors of bone. ADAM12 might be associated with tumor progression, metastasis, or therapy resistance. The encoded protein serves as a marker for chemoresistance in estrogen receptor-negative tumors. ADAM12 has the ability to induce cancer stem cell phenotype in breast cancer cells. Increased expression of this gene is observed during epithelial-to-mesenchymal transition, associated with claudin-low breast tumors. Upregulation of the gene is observed in small cell lung cancer.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST77731

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable